HPA023051

LYRM9 antibody from MilliporeSigma / Merck KGaA
C17orf108, HSD24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023051
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023051, RRID:AB_10602333
Product name
Anti-C17orf108 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023051
Antibody type
Polyclonal
Antigen
UPF0631 protein HSD24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSD
EDNPERIQQIIKRAIEDADWIM
Storage
-20C
Provider Type Product Number
- No reagents -