H00000214-M02A

ALCAM antibody from Abnova Corporation
CD166, MEMD
No application information provided.

Antibody data

Product number
H00000214-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000214-M02A, RRID:AB_1572290
Product name
ALCAM monoclonal antibody (M02A), clone 1H3
Provider product page
Abnova Corporation - H00000214-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ALCAM.
Antigen sequence
WYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPD
GSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYT
LSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFK
QPSKP
Isotype
IgM
Antibody clone number
1H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -