HPA010926

ALCAM antibody from Sigma-Aldrich
CD166, MEMD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010926
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010926, RRID:AB_1078449
Product name
Anti-ALCAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010926
Antibody type
Polyclonal
Antigen
CD166 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYT
LTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDL
SLNPSGEVTRQIGDALPVSCTISASRNATVVWMKD
NIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKK
R
Storage
-20C
Provider Type Product Number
- No reagents -