HPA028379

INTS11 antibody from Sigma-Aldrich
CPSF3L, CPSF73L, FLJ20542, INT11, RC-68
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028379
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028379, RRID:AB_10599598
Product name
Anti-CPSF3L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028379
Antibody type
Polyclonal
Antigen
cleavage and polyadenylation specific factor 3-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKS
VLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKV
LLVSWTYQDEELGSFLTSLLKKG
Storage
-20C
Provider Type Product Number
- No reagents -