HPA017740

EMB antibody from MilliporeSigma / Merck KGaA
MGC71745
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017740
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017740, RRID:AB_1848138
Product name
Anti-EMB antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017740
Antibody type
Polyclonal
Antigen
Embigin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTSPPLREEIMANNFSLESHNISLTEHSSMPVEKN
ITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQL
ENNYLVSATGSTLYTQYRFTIINSKQMGSYSCFFR
EEKEQRGT
Storage
-20C
Provider Type Product Number
- No reagents -