Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017740 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-EMB
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FTSPPLREEIMANNFSLESHNISLTEHSSMPVEKN
ITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQL
ENNYLVSATGSTLYTQYRFTIINSKQMGSYSCFFR
EEKEQRGT- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Localization of MCT2 at peroxisomes is associated with malignant transformation in prostate cancer.
Monocarboxylate transporter 4 (MCT4) and CD147 overexpression is associated with poor prognosis in prostate cancer.
Valença I, Pértega-Gomes N, Vizcaino JR, Henrique RM, Lopes C, Baltazar F, Ribeiro D
Journal of cellular and molecular medicine 2015 Apr;19(4):723-33
Journal of cellular and molecular medicine 2015 Apr;19(4):723-33
Monocarboxylate transporter 4 (MCT4) and CD147 overexpression is associated with poor prognosis in prostate cancer.
Pértega-Gomes N, Vizcaíno JR, Miranda-Gonçalves V, Pinheiro C, Silva J, Pereira H, Monteiro P, Henrique RM, Reis RM, Lopes C, Baltazar F
BMC cancer 2011 Jul 25;11:312
BMC cancer 2011 Jul 25;11:312
No comments: Submit comment
No validations: Submit validation data