ABIN406428

HADH antibody from antibodies-online
HADH1, HADHSC, SCHAD

Antibody data

Product number
ABIN406428
Provider
antibodies-online
Product name
anti-Hydroxyacyl-CoA Dehydrogenase (HADH) (C-Term) antibody
Provider product page
antibodies-online - ABIN406428
Antibody type
Polyclonal
Antigen
The immunogen for anti-HADH antibody: synthetic peptide directed towards the C terminal of human HADH
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQ
PSPSL NKLVAENKFG
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -