Antibody data

Product number
ABIN405707
Provider
antibodies-online
Product name
anti-Galactosylceramidase (GALC) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405707
Antibody type
Polyclonal
Antigen
The immunogen for anti-GALC antibody: synthetic peptide directed towards the middle region of human GALC
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYL
KTVGH LEKGGSYVAL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -