HPA011036

ARMC10 antibody from Sigma-Aldrich
MGC3195, SVH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011036, RRID:AB_1080139
Product name
Anti-ARMC10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011036
Antibody type
Polyclonal
Antigen
SVH protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERAL
ITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQS
IKEKALNALNNLSVNVEN
Storage
-20C
Provider Type Product Number
- No reagents -