Antibody data

Product number
H00055287-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055287-B01, RRID:AB_1205088
Product name
TMEM40 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055287-B01
Antibody type
Polyclonal
Antigen
TMEM40 (AAH20658, 1 a.a. ~ 203 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
METSASSSQPQDNSQVHRETEDVDYGETDFHKQDG
KAGLFSQEQYERNKSSSSSSSSSSSSSSSSSSSSS
GPGHGEPDVLKDELQLYGDAPGEVVPSGESGLRRR
GSDPASGEVEASQLRRLNIKKDDEFFHFVLLCFAI
GALLVCYHYYADWFMSLGVGLLTFASLETVGIYFG
LVYRIHSVLQGFIPLFQKFRLTGFRKTD
Vial size
50 μl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -