Antibody data

Product number
H00004891-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004891-M05, RRID:AB_1137450
Product name
SLC11A2 monoclonal antibody (M05), clone 2F11
Provider product page
Abnova Corporation - H00004891-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
Antigen sequence
MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPS
LSQSPGDSEEYFATYFNEKISIPEEEYSCF
Isotype
IgG
Antibody clone number
2F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -