H00008554-B01

PIAS1 antibody from Abnova Corporation
DDXBP1, GBP, GU/RH-II, ZMIZ3

Antibody data

Product number
H00008554-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008554-B01, RRID:AB_11189052
Product name
PIAS1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00008554-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PIAS1 protein.
Antigen sequence
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKH
ELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIM
TPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPAS
SPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQK
LPFYDLLDELIKPTSLASDNSQRFRETCFAFALTP
QQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCP
QEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKR
PSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSM
AVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEK
LTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALT
CSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEH
LIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNK
KVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPL
NNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQ
DYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSL
LAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSA
GGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVT
NRSSTDTASIFGIIPDIISLD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -