Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406627 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Spermatogenesis Associated 7 (SPATA7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPATA7 antibody: synthetic peptide directed towards the middle region of human SPATA7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSE
LGTAE TKNMTDSEMN- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
No validations: Submit validation data