HPA012748

C11orf24 antibody from Sigma-Aldrich
DM4E3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012748
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012748, RRID:AB_1845526
Product name
Anti-C11orf24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012748
Antibody type
Polyclonal
Antigen
Uncharacterized protein C11orf24 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRP
QAQGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAP
TPTVVTTTKAQAREPTASPVPVPHTSPIPEMEAMS
PTTQPSPMPYTQRAAGPGTSQAPEQVETEATPGT
Storage
-20C
Provider Type Product Number
- No reagents -