Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001855-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001855-A01, RRID:AB_462298
- Product name
- DVL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant DVL1.
- Antigen sequence
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKN
VLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL
PCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPP
LERTG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z
BMC cancer 2007 Mar 27;7:55
BMC cancer 2007 Mar 27;7:55
No comments: Submit comment
No validations: Submit validation data