Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000722 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000722, RRID:AB_1078283
- Product name
- Anti-BID
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDA
LGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEA
DSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGL
ALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEK
EKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFIN
QNLRTYVRSLAR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Exploring the contextual sensitivity of factors that determine cell-to-cell variability in receptor-mediated apoptosis.
Lyapunov exponents and phase diagrams reveal multi-factorial control over TRAIL-induced apoptosis.
Non-genetic origins of cell-to-cell variability in TRAIL-induced apoptosis
Gaudet S, Spencer SL, Chen WW, Sorger PK
PLoS computational biology 2012;8(4):e1002482
PLoS computational biology 2012;8(4):e1002482
Lyapunov exponents and phase diagrams reveal multi-factorial control over TRAIL-induced apoptosis.
Aldridge BB, Gaudet S, Lauffenburger DA, Sorger PK
Molecular systems biology 2011 Nov 22;7:553
Molecular systems biology 2011 Nov 22;7:553
Non-genetic origins of cell-to-cell variability in TRAIL-induced apoptosis
Spencer S, Gaudet S, Albeck J, Burke J, Sorger P
Nature 2009 April;459(7245):428-432
Nature 2009 April;459(7245):428-432
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines MCF-7 and HeLa using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human bone marrow and testis tissues using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN