HPA013180

NETO2 antibody from Atlas Antibodies
FLJ10430, NEOT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013180
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013180, RRID:AB_1854383
Product name
Anti-NETO2
Provider product page
Atlas Antibodies - HPA013180
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFE
CRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTG
RFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGG
ILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQA
VDCIWTIKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -