H00113235-B01P

SLC46A1 antibody from Abnova Corporation
HCP1, MGC9564, PCFT
No application information provided.

Antibody data

Product number
H00113235-B01P
Provider
Abnova Corporation
Product name
SLC46A1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00113235-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SLC46A1 protein.
Antigen sequence
MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFA
LVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRS
ADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLG
AWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLH
VGYFVLGRILCALLGDFGGLLAASFASVADVSSSR
SRTFRMALLEASIGVAGMLASLLGGHWLRAQGYAN
PFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTF
RHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITV
HFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPY
LTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFA
FATITPLMFTGALFSAVACVNSLAMLTASGIFNSL
YPATLNFMKGFPFLLGAGLLLIPAVLIGMLEKADP
HLEFQQFPQSP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -