HPA014745

LRRC8D antibody from Sigma-Aldrich
FLJ10470, LRRC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014745
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014745, RRID:AB_1853348
Product name
Anti-LRRC8D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014745
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 8D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIPPSITHVKNLESLYFSNNKLESLPVAVFSLQKL
RCLDVSYNNISMIPIEIGLLQNLQHLHITGNKVDI
LPKQLFKCIKLRTLNLGQNCITSLPEKVGQLSQLT
QLELKGNCLDRLPAQLGQCRMLKKSG
Storage
-20C
Provider Type Product Number
- No reagents -