HPA012412

CLSTN1 antibody from Sigma-Aldrich
CDHR12, CSTN1, KIAA0911
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012412
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012412, RRID:AB_1846981
Product name
Anti-CLSTN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012412
Antibody type
Polyclonal
Antigen
Calsyntenin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVE
NDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSG
KLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAH
PSQLVLTLEGEDLGELDKAMQHISYLNS
Storage
-20C
Provider Type Product Number
- No reagents -