HPA012412

CLSTN1 antibody from Atlas Antibodies
CDHR12, CSTN1, KIAA0911
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012412
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012412, RRID:AB_1846981
Product name
Anti-CLSTN1
Provider product page
Atlas Antibodies - HPA012412
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVE
NDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSG
KLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAH
PSQLVLTLEGEDLGELDKAMQHISYLNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -