Antibody data

Product number
H00007071-M20
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007071-M20, RRID:AB_1137271
Product name
KLF10 monoclonal antibody (M20), clone 2H7
Provider product page
Abnova Corporation - H00007071-M20
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KLF10.
Antigen sequence
LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVI
RHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHL
NVEAARKNIPCAAVSPNRSKCERNTVADVD
Isotype
IgG
Antibody clone number
2H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -