HPA044769

GSPT2 antibody from Atlas Antibodies
eRF3b, FLJ10441
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044769
Provider
Atlas Antibodies
Product name
Anti-GSPT2
Provider product page
Atlas Antibodies - HPA044769
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVE
PSREEPLVSLEGSNSAVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -