HPA044769

GSPT2 antibody from Atlas Antibodies
eRF3b, FLJ10441
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044769
Provider
Atlas Antibodies
Product name
Anti-GSPT2
Provider product page
Atlas Antibodies - HPA044769
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVE
PSREEPLVSLEGSNSAVT
Isotype
IgG
Vial size (┬Ál)
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -