HPA011746

FRMD5 antibody from Sigma-Aldrich
MGC14161
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011746
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011746, RRID:AB_1078912
Product name
Anti-FRMD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011746
Antibody type
Polyclonal
Antigen
FERM domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRD
SAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCS
IEEEKESEAST
Storage
-20C
Provider Type Product Number
- No reagents -