HPA013961

FRMD5 antibody from MilliporeSigma / Merck KGaA
MGC14161
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013961
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013961, RRID:AB_1849149
Product name
Anti-FRMD5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013961
Antibody type
Polyclonal
Antigen
FERM domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRL
LCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKF
QFFPKHSEKLERKIAEIHKTELSGQTPATSELNFL
RKAQTLETYGVDPHPCKDVSGN
Storage
-20C
Provider Type Product Number
- No reagents -