H00051582-M02

AZIN1 antibody from Abnova Corporation
OAZI, OAZIN, ODC1L
No application information provided.

Antibody data

Product number
H00051582-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051582-M02, RRID:AB_1571597
Product name
AZIN1 monoclonal antibody (M02), clone 1F11
Provider product page
Abnova Corporation - H00051582-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AZIN1.
Antigen sequence
HKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPEL
NVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMS
FSDWYEMQDAGITSDSMMKNFFFVPSCIQLSQEDS
FSAE
Isotype
IgG
Antibody clone number
1F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -