HPA027948

AZIN1 antibody from Sigma-Aldrich
OAZI, OAZIN, ODC1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027948, RRID:AB_10602391
Product name
Anti-AZIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027948
Antibody type
Polyclonal
Antigen
antizyme inhibitor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATE
DNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIG
VKFHVSSACKESQVYV
Storage
-20C
Provider Type Product Number
- No reagents -