HPA017265

CYP4F11 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017265
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017265, RRID:AB_1847451
Product name
Anti-CYP4F11 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017265
Antibody type
Polyclonal
Antigen
Cytochrome P450 4F11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKT
LTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPIT
SASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSR
HRRMLTPAF
Storage
-20C
Provider Type Product Number
- No reagents -