HPA015737

EIF2AK3 antibody from Sigma-Aldrich
PEK, PERK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015737
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015737, RRID:AB_1848062
Product name
Anti-EIF2AK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015737
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 2-alpha kinase 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPM
DAPSVKIRRMDPFATKEHIEIIAPSPQRSRSFSVG
ISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYN
LQDSCLTDCDVEDGTMDGNDE
Storage
-20C
Provider Type Product Number
- No reagents -