Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00081579-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00081579-M01, RRID:AB_509381
- Product name
- PLA2G12A monoclonal antibody (M01), clone 1D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLA2G12A.
- Antigen sequence
PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDC
DEEFQYCLSKICRDVQKTLGLTQHVQACETTVELL
FDSVIHLGCKPYLDSQRAACRCHYEEKTD- Isotype
- IgG
- Antibody clone number
- 1D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of group XIIA phospholipase A2 in human digestive organs.
Peuravuori H, Kollanus S, Nevalainen TJ
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2014 Dec;122(12):1171-7
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica 2014 Dec;122(12):1171-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody (M01), clone 1D11.Lane 1: PLA2G12A transfected lysate(21.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol