Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079870-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079870-M01, RRID:AB_1571606
- Product name
- BAALC monoclonal antibody (M01), clone 2A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BAALC.
- Antigen sequence
PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSS
GPLTQKQNGLQTTEAKRDAKRMPAKEVTINVTDSI
QQMDRSRRITKNCVN- Isotype
- IgG
- Antibody clone number
- 2A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references iTRAQ-based proteomics reveals novel biomarkers of osteoarthritis.
Ikeda D, Ageta H, Tsuchida K, Yamada H
Biomarkers : biochemical indicators of exposure, response, and susceptibility to chemicals 2013 Nov;18(7):565-72
Biomarkers : biochemical indicators of exposure, response, and susceptibility to chemicals 2013 Nov;18(7):565-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BAALC expression in transfected 293T cell line by BAALC monoclonal antibody (M01), clone 2A2.Lane 1: BAALC transfected lysate (Predicted MW: 15.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BAALC is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol