H00408263-B01

FNDC9 antibody from Abnova Corporation
C5orf40, MGC27121

Antibody data

Product number
H00408263-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00408263-B01, RRID:AB_1204677
Product name
MGC27121 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00408263-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC27121 protein.
Antigen sequence
MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPN
WNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPST
LYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSS
LVDPQISLWVLMAILLACFTAVLAFICLQFWCVRC
HEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDL
QGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQR
GGGDPPAILPHCGE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -