HPA011115

FNDC9 antibody from Atlas Antibodies
C5orf40, MGC27121
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011115
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011115, RRID:AB_1079374
Product name
Anti-FNDC9
Provider product page
Atlas Antibodies - HPA011115
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREE
DLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGAL
QRGGGDPPAILPHCG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -