HPA011115

FNDC9 antibody from Sigma-Aldrich
C5orf40, MGC27121
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011115
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011115, RRID:AB_1079374
Product name
Anti-C5orf40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011115
Antibody type
Polyclonal
Antigen
Fibronectin type-III domain-containing protein C5orf40 gene recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREE
DLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGAL
QRGGGDPPAILPHCG
Storage
-20C
Provider Type Product Number
- No reagents -