PAB20530

MANEA antibody from Abnova Corporation
FLJ12838, mandaselin

Antibody data

Product number
PAB20530
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20530, RRID:AB_10970590
Product name
MANEA polyclonal antibody
Provider product page
Abnova Corporation - PAB20530
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MANEA.
Antigen sequence
GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYN
LKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAF
YRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSG
SRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIY
T
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -