HPA011070

GAPT antibody from Sigma-Aldrich
C5orf29, FLJ33641
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011070
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011070, RRID:AB_1848887
Product name
Anti-GAPT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011070
Antibody type
Polyclonal
Antigen
Protein GAPT recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHE
ISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKT
DKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPS
EVPQDED
Storage
-20C
Provider Type Product Number
- No reagents -