H00051251-B01P

NT5C3A antibody from Abnova Corporation
cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1

Antibody data

Product number
H00051251-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051251-B01P, RRID:AB_1138724
Product name
NT5C3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051251-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NT5C3 protein.
Antigen sequence
MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQI
ITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTK
SHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFD
KLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVK
VVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNT
EYFNQLKDNSNIILLGDSQGDLRMADGVANVEHIL
KIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANS
ILQKIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -