Antibody data

Product number
H00057633-M11
Provider
Abnova Corporation
Product name
LRRN1 monoclonal antibody (M11), clone 3F1
Provider product page
Abnova Corporation - H00057633-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LRRN1.
Antigen sequence
MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQL
CVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNL
SSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQN
NFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQ
DLSNLQELYINHNQISTISAHAFAGLKNLLRLHLN
SNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMN
FKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLS
FYDNKLVKVPQLALQKVPSLKFLDLNKNPIHKIQE
GDFKNMLRLKELGINNMGELVSVDRYALDNLPELT
KLEATNNPKLSYIHRLAFRSVPALESLMLNNNALN
AIYQKTVESLPNLREISIHSNPLRCDCVIHWINSN
KTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEP
EIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQ
IEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQ
VLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSAT
MKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVC
LTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETST
ALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSL
KKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSA
DTKPTQVDTSRSYYMW
Isotype
IgG
Antibody clone number
3F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -