Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055821-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055821-M07, RRID:AB_1672249
- Product name
- ALLC monoclonal antibody (M07), clone 3D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALLC.
- Antigen sequence
GHPNNIIGVGGAKSMADGWETARRLDRPPILENDE
NGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGN
APDSCKVDGCILTTQEEAVIRQKWILPAHKWKPLL
PVTKL- Isotype
- IgG
- Antibody clone number
- 3D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ALLC expression in transfected 293T cell line by ALLC monoclonal antibody (M07), clone 3D3.Lane 1: ALLC transfected lysate(45.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ALLC is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ALLC transfected lysate using anti-ALLC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ALLC MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol