H00025776-M06
antibody from Abnova Corporation
Targeting: CBY1
C22orf2, Cby, Chibby, Chibby1, PGEA1, PIGEA-14, PIGEA14
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00025776-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00025776-M06, RRID:AB_530170
- Product name
- CBY1 monoclonal antibody (M06), clone 2F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CBY1.
- Antigen sequence
SASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSL
KFENGQWIAETGVSGGVDRREVQRLRRRNQQLEEE
NNLLRLKVDILLDMLSESTAESHLMEKELDELRIS
RKRK- Isotype
- IgG
- Antibody clone number
- 2F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CBY1 expression in transfected 293T cell line by CBY1 monoclonal antibody (M06), clone 2F2.Lane 1: CBY1 transfected lysate (Predicted MW: 14.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CBY1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol