H00028973-B01P

MRPS18B antibody from Abnova Corporation
C6orf14, HSPC183, MRPS18-2, PTD017

Antibody data

Product number
H00028973-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028973-B01P, RRID:AB_1138674
Product name
MRPS18B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00028973-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPS18B protein.
Antigen sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTK
APSEEDSLSSVPISPYKDEPWKYLESEEYQERYGS
RPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPC
PICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYT
GVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDL
DFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPE
RELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAE
ASSTGQTGPQSAL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -