HPA000953

MYO18B antibody from Sigma-Aldrich
BK125H2.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000953
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000953, RRID:AB_1079440
Product name
Anti-MYO18B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000953
Antibody type
Polyclonal
Antigen
Myosin-XVIIIb recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTP
TSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIK
TILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSI
KSRPGIPRLAGDGGERTSPERREPGTGRKDDDVAS
IMKKY
Storage
-20C
Provider Type Product Number
- No reagents -