Antibody data

Product number
PAB20998
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20998, RRID:AB_10965207
Product name
LYSMD3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20998
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LYSMD3.
Antigen sequence
FSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPAN
DSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLN
EVVSALTAQQMRFEPDNKNTQRKDPYYGADW
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.