HPA018024

LYSMD3 antibody from MilliporeSigma / Merck KGaA
FLJ13542
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018024
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018024, RRID:AB_2138525
Product name
Anti-LYSMD3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018024
Antibody type
Polyclonal
Antigen
LysM and putative peptidoglycan-binding domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPAN
DSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLN
EVVSALTAQQMRFEPDNKNTQRKDPYYGADW
Storage
-20C
Provider Type Product Number
- No reagents -