Antibody data

Product number
HPA018024
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018024, RRID:AB_2138525
Product name
Anti-LYSMD3
Provider product page
Atlas Antibodies - HPA018024
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPAN
DSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLN
EVVSALTAQQMRFEPDNKNTQRKDPYYGADW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.