H00004762-M06
antibody from Abnova Corporation
Targeting: NEUROG1
AKA, bHLHa6, Math4C, NEUROD3, ngn1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004762-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004762-M06, RRID:AB_581587
- Product name
- NEUROG1 monoclonal antibody (M06), clone 4A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEUROG1.
- Antigen sequence
SEALLHSLRRSRRVKANDRERNRMHNLNAALDALR
SVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLA
DQGLPGGGARER- Isotype
- IgG
- Antibody clone number
- 4A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NEUROG1 monoclonal antibody (M06), clone 4A2 Western Blot analysis of NEUROG1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NEUROG1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NEUROG1 on HeLa cell. [antibody concentration 50 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol