HPA011145

SMIM19 antibody from Sigma-Aldrich
C8orf40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011145
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011145, RRID:AB_1078360
Product name
Anti-C8orf40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011145
Antibody type
Polyclonal
Antigen
UPF0697 protein C8orf40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRNKRRIMRIFSVPPTEETLSEPNFYDTISKIRLR
QQLEMYSISRKYDYQQPQNQADSVQLSLE
Storage
-20C
Provider Type Product Number
- No reagents -