Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009498-M04 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009498-M04, RRID:AB_535031
- Product name
- SLC4A8 monoclonal antibody (M04), clone 6E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC4A8.
- Antigen sequence
- IEEISDLILDQQELSSDLNDSMRVKVREALLKKHH
 HQNEKKRNNLIPIVRSFAEVGKKQSDPHLMDKHGQ
 TVSPQSVPTTNLEVKNGVNCEHSPVDLSKV
- Isotype
- IgG
- Antibody clone number
- 6E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Negative shift in the glycine reversal potential mediated by a Ca2+- and pH-dependent mechanism in interneurons.
				
		
	
			Kim Y, Trussell LO
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Sep 16;29(37):11495-510
		The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Sep 16;29(37):11495-510
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged SLC4A8 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoperoxidase of monoclonal antibody to SLC4A8 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol