Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009498-M05 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009498-M05, RRID:AB_1112325
- Product name
- SLC4A8 monoclonal antibody (M05), clone 1G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC4A8.
- Antigen sequence
- IEEISDLILDQQELSSDLNDSMRVKVREALLKKHH
 HQNEKKRNNLIPIVRSFAEVGKKQSDPHLMDKHGQ
 TVSPQSVPTTNLEVKNGVNCEHSPVDLSKV
- Isotype
- IgG
- Antibody clone number
- 1G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Negative shift in the glycine reversal potential mediated by a Ca2+- and pH-dependent mechanism in interneurons.
				
		
	
			Kim Y, Trussell LO
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Sep 16;29(37):11495-510
		The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Sep 16;29(37):11495-510
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- SLC4A8 monoclonal antibody (M05), clone 1G10. Western Blot analysis of SLC4A8 expression in NIH/3T3 ( Cat # L018V1 ).