Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009567-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009567-M01, RRID:AB_622324
- Product name
- GTPBP1 monoclonal antibody (M01), clone 1H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GTPBP1.
- Antigen sequence
MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATV
KSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGD
NDFLEV- Isotype
- IgG
- Antibody clone number
- 1H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody (M01), clone 1H1.Lane 1: GTPBP1 transfected lysate(63.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GTPBP1 transfected lysate using anti-GTPBP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GTPBP1 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol